Iright
BRAND / VENDOR: Proteintech

Proteintech, 83265-8-RR, DUS2L Recombinant monoclonal antibody

CATALOG NUMBER: 83265-8-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The DUS2L (83265-8-RR) by Proteintech is a Recombinant antibody targeting DUS2L in WB, ELISA applications with reactivity to human, mouse samples 83265-8-RR targets DUS2L in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, RAW 264.7 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Dihydrouridine synthase 2(DUS2L), is a cytoplasmic protein that catalyzes the conversion of uridine residues to dihydrouridine in the D-loop of tRNA. transfection of DUS2 cDNA into a human lung carcinoma cell line increased dihydrouridine in tRNA, whereas transfection of DUS2 small interfering RNA (siRNA) reduced tRNA-dihydrouridine, confirming that DUS2 has dihydrouridine synthase activity. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23831 Product name: Recombinant human DUS2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-493 aa of BC006527 Sequence: SHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRLLHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTSGVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPLEGW Predict reactive species Full Name: dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae) Observed Molecular Weight: 55 kDa GenBank Accession Number: BC006527 Gene Symbol: DUS2L Gene ID (NCBI): 54920 RRID: AB_3670938 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NX74 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924