Iright
BRAND / VENDOR: Proteintech

Proteintech, 83270-2-RR, DOCK8 Recombinant monoclonal antibody

CATALOG NUMBER: 83270-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The DOCK8 (83270-2-RR) by Proteintech is a Recombinant antibody targeting DOCK8 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83270-2-RR targets DOCK8 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells, Raji cells, THP-1 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Positive FC (Intra) detected in: HeLa cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DOCK8 is a member of the DOCK family of proteins, which have a unique DRH2 domain enabling them to act as GEFs and so controlling a range of cellular processes in various signaling pathways (PMID: 12432077). The specific target of DOCK8 is Cell division control protein 42 homolog (Cdc42), a small GTPase that is involved in regulation of the cell cycle and forms a complex. DOCK8 also acts as a scaffold molecule in this complex that initiates actin polymerization via the Wiskott-Aldrich Syndrome protein (WASp) (PubMed: 28028151, PubMed: 22461490). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34585 Product name: Recombinant human DOCK8 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 257-606 aa of BC019102 Sequence: EVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFFGSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS Predict reactive species Full Name: dedicator of cytokinesis 8 Calculated Molecular Weight: 2031 aa, 231 kDa Observed Molecular Weight: 239 kDa GenBank Accession Number: BC019102 Gene Symbol: DOCK8 Gene ID (NCBI): 81704 RRID: AB_3670943 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8NF50 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924