Proteintech, 83272-1-RR, KERA Recombinant monoclonal antibody

Size: 20ul / 100ul The KERA (83272-1-RR) by Proteintech is a Recombinant antibody targeting KERA in IF-P, FC (Intra), ELISA applications with reactivity to human samples 83272-1-RR targets KERA in IF-P, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF-P detected in: rat eye tissue Positive FC (Intra) detected in: U251 Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Keratocan and Lumican are the predominant class II SLRPs(Small leucine-rich proteoglycans) in the corneal stroma. While not totally corneal-specific together these SLRPs are excellent biomarkers for the tissue. Mutant mice deficient for keratocan expression have transparent but thin corneal stromas with a mild increase in collagen fibril diameter with no further abnormalities.In humans, mutations in the keratocan gene are associated with a flattened cornea in a rare condition known as cornea plana. The relative specificity of keratocan to corneal keratocytes has been useful for tissue-specific targeting for genetic manipulation of the corneal stroma.(PMID: 32663498) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34171 Product name: Recombinant human KERA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-320 aa of BC032667 Sequence: RLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGP Predict reactive species Full Name: keratocan Calculated Molecular Weight: 352 aa, 41 kDa GenBank Accession Number: BC032667 Gene Symbol: KERA Gene ID (NCBI): 11081 RRID: AB_3670944 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O60938 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.