Iright
BRAND / VENDOR: Proteintech

Proteintech, 83293-1-RR, GINS1 Recombinant monoclonal antibody

CATALOG NUMBER: 83293-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The GINS1 (83293-1-RR) by Proteintech is a Recombinant antibody targeting GINS1 in WB, ELISA applications with reactivity to human samples 83293-1-RR targets GINS1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GINS1, also known as Partner of SLD Five 1 (PSF1) is a member of the GINS (Go-Ichi-Nii-San) complex, which plays a vital role in the initiation and elongation of DNA replication (PMID: 34414190). GINS1 was initially found to be predominantly expressed in highly proliferating cells instead of mature cells. Later on, it was found that GINS was involved in the tumorigenesis of various cancers, including breast cancer, colorectal cancer, and hepatocellular carcinoma (PMID: 36065190). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8895 Product name: Recombinant human GINS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC012542 Sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS Predict reactive species Full Name: GINS complex subunit 1 (Psf1 homolog) Calculated Molecular Weight: 196 aa, 23 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC012542 Gene Symbol: GINS1 Gene ID (NCBI): 9837 RRID: AB_3670960 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14691 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924