Proteintech, 83307-3-RR, Histone H2A.X Recombinant monoclonal antibody

Size: 20ul / 100ul The Histone H2A 83307-3-RR targets Histone H2A.X in WB, IHC, IF/ICC, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, NIH/3T3 cells, C6 cells Positive IHC detected in: human kidney(renal cell) CancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Positive ChIP-qPCR detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:750-1:3000 CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information Histone H2A.X belongs to the histone H2A family, which is synthesized in G1 and S phase. It is involved in nucleosomal organization of chromatin together with other histone proteins, and is specially important for recombination between immunoglobulin switch regions. H2A.X becomes phosphorylated on serine 139 (to form gamma-H2AFX or H2AX139ph) in response to DNA double strand breaks (DSBs) generated by exogenous genotoxic agents and by stalled replication forks, which promotes DNA repair and maintains genomic stability. The calculated molecular weight of H2AX is 15 kDa, but the ubiquitinated H2A.X is about 22 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1305 Product name: Recombinant human Histone H2A.X protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC013416 Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY Predict reactive species Full Name: H2A histone family, member X Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 15-18 kDa, 22 kDa GenBank Accession Number: BC013416 Gene Symbol: Histone H2A.X Gene ID (NCBI): 3014 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.