Proteintech, 83345-1-RR, LYPD3 Recombinant monoclonal antibody

Size: 20ul / 100ul The LYPD3 (83345-1-RR) by Proteintech is a Recombinant antibody targeting LYPD3 in WB, ELISA applications with reactivity to human samples 83345-1-RR targets LYPD3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HaCaT cells, SK-BR-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information LYPD3 (Ly6/PLAUR domain-containing protein 3), also known as C4.4A , is a membrane protein anchored to the cell surface via a glycosylphosphatidylinositol (GPI) moiety (PMID: 25302166; 15012588). It is a tumorigenic and high-glycosylated protein that has been proven to be linked with the carcinogenic effects in different solid tumors, such as lung cancer and breast cancer (PMID: 32040344; 29371917; 31644911). It has been shown that the elevated expression of LYPD3 is associated with lung adenocarcinoma carcinogenesis and poor prognosis (PMID: 25302166; 32040344). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34961 Product name: Recombinant human LYPD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-326 aa of NM_014400 Sequence: LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC Predict reactive species Full Name: LY6/PLAUR domain containing 3 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: NM_014400 Gene Symbol: LYPD3 Gene ID (NCBI): 27076 RRID: AB_3671004 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95274 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.