Iright
BRAND / VENDOR: Proteintech

Proteintech, 83349-3-RR, AGPAT2 Recombinant monoclonal antibody

CATALOG NUMBER: 83349-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The AGPAT2 (83349-3-RR) by Proteintech is a Recombinant antibody targeting AGPAT2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 83349-3-RR targets AGPAT2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, THP-1 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2) belongs to a family of enzymes catalyzing the sn-2 acylation of the glycerol-3-phosphate backbone. AGPAT2 is highly expressed in adipose tissues, liver, and skeletal muscle. AGPAT2 is the only AGPAT isoform whose loss-of-function mutations cause a severe form of human congenital generalized lipodystrophy (PMID: 34824276). Human and mouse AGPAT2 have a calculated molecular mass of 31 kDa, and an alternatively spliced form of AGPAT2 mRNA, encoding a protein of 246 rather than 278 amino acids, is also found in human (PMID: 19336658). Western detected AGPAT2 at an apparent molecular mass of 27 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34761 Product name: Recombinant human AGPAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-279 aa of BC019292 Sequence: VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ Predict reactive species Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC019292 Gene Symbol: AGPAT2 Gene ID (NCBI): 10555 RRID: AB_3671007 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15120 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924