Proteintech, 83352-1-RR, FGR Recombinant monoclonal antibody

Size: 20ul / 100ul The FGR (83352-1-RR) by Proteintech is a Recombinant antibody targeting FGR in WB, IF/ICC, ELISA applications with reactivity to human samples 83352-1-RR targets FGR in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells Positive IF/ICC detected in: Raji cells Positive FC (Intra) detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FGR (Tyrosine-protein kinase Fgr) is a member of the Src family of protein tyrosine kinases (PTKs). It's contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34944 Product name: Recombinant human FGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of NM_005248 Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA Predict reactive species Full Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_005248 Gene Symbol: FGR Gene ID (NCBI): 2268 RRID: AB_3671010 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.