Iright
BRAND / VENDOR: Proteintech

Proteintech, 83360-2-RR, SLC25A46 Recombinant monoclonal antibody

CATALOG NUMBER: 83360-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SLC25A46 (83360-2-RR) by Proteintech is a Recombinant antibody targeting SLC25A46 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83360-2-RR targets SLC25A46 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, MCF-7 cells, HeLa cells, Jurkat cells, MDA-MB-231 cells, mouse brain tissue Positive FC (Intra) detected in: Caco-2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Solute carrier family 25 member 46 (SLC25A46), a highly conserved protein among various species including vertebrates, is a nuclear gene encoding mitochondrial carriers. SLC25A46 is involved in mitochondrial fission and the transport of lipids from the endoplasmic reticulum to mitochondria (PMID: 33277645). SLC25A46 has 3 isoforms with molecular weights of 30, 37 and 46 kDa, respectively. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27293 Product name: Recombinant human SLC25A46 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 222-382 aa of BC017169 Sequence: IETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIRQEEGV Predict reactive species Full Name: solute carrier family 25, member 46 Calculated Molecular Weight: 418 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC017169 Gene Symbol: SLC25A46 Gene ID (NCBI): 91137 RRID: AB_3671014 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96AG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924