Iright
BRAND / VENDOR: Proteintech

Proteintech, 83384-2-RR, NLRC5 Recombinant monoclonal antibody

CATALOG NUMBER: 83384-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NLRC5 (83384-2-RR) by Proteintech is a Recombinant antibody targeting NLRC5 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83384-2-RR targets NLRC5 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: THP-1 cells Positive FC (Intra) detected in: THP-1 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The nucleotide-binding domain leucine-rich repeat containing (NLR) family of proteins is mainly involved in microbial pathogen recognition, inflammatory responses, and cell death. NLRC5, the largest member of the NLR family, is currently receiving an increasing level of attention. NLRC5 plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34508 Product name: Recombinant human NLRC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC063566 Sequence: MDPVGLQLGNKNLWSCLVRLLTKDPEWLNAKMKFFLPNTDLDSRNETLDPEQRVILQLNKLHVQGSDTWQSFIHCVCMQLEVPLDLEVLLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQLELAKKYLQLLRTSAQQRYR Predict reactive species Full Name: NLR family, CARD domain containing 5 Calculated Molecular Weight: 204 kDa GenBank Accession Number: BC063566 Gene Symbol: NLRC5 Gene ID (NCBI): 84166 RRID: AB_3671040 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86WI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924