Proteintech, 83389-4-RR, SIAH1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SIAH1 (83389-4-RR) by Proteintech is a Recombinant antibody targeting SIAH1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 83389-4-RR targets SIAH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse kidney tissue, HepG2 cells, HEK-293T cells, SH-SY5Y cells, Jurkat cells, COLO 320 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SIAH1, also named as HUMSIAH, Siah-1a and Siah-1S(21kd), belongs to the SINA (Seven in absentia) family. SIAH1 is known to cause indirect degradation of beta-catenin through formation of a complex with Siah-interacting protein (SIP), Skp1 and Ebi. SIAH1 can form heterodimer or homodimer such as Siah-1*Siah-1(70 or 62kd), Siah-1*Siah-1S(42kd) and Siah-1S*Siah-1S(51-56kd). Importantly, results from in vitro soft agar assay demonstrated that Siah-1S displays a promotion effect on cells tumorigenicity. (PMID:17420721) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34618 Product name: Recombinant human SIAH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC035562 Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLP Predict reactive species Full Name: seven in absentia homolog 1 (Drosophila) Calculated Molecular Weight: 282 aa, 31 kDa Observed Molecular Weight: 30-34 kDa GenBank Accession Number: BC035562 Gene Symbol: SIAH1 Gene ID (NCBI): 6477 RRID: AB_3671043 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8IUQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.