Proteintech, 83424-1-RR, IFI44 Recombinant monoclonal antibody

Size: 20ul / 100ul The IFI44 (83424-1-RR) by Proteintech is a Recombinant antibody targeting IFI44 in WB, FC (Intra), ELISA applications with reactivity to human samples 83424-1-RR targets IFI44 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26121 Product name: Recombinant human IFI44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-175 aa of BC022870 Sequence: RLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALR Predict reactive species Full Name: interferon-induced protein 44 Calculated Molecular Weight: 444 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC022870 Gene Symbol: IFI44 Gene ID (NCBI): 10561 RRID: AB_3671073 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8TCB0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.