Iright
BRAND / VENDOR: Proteintech

Proteintech, 83443-6-RR, NEDD1 Recombinant monoclonal antibody

CATALOG NUMBER: 83443-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NEDD1 (83443-6-RR) by Proteintech is a Recombinant antibody targeting NEDD1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83443-6-RR targets NEDD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A431 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor), also known as GCP-WD. It is expected to be located in centrosome; nucleoplasm; and plasma membrane. Required for mitosis progression. Promotes the nucleation of microtubules from the spindle. The molecular weight of NEDD1is 72 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33603 Product name: Recombinant human NEDD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC027605 Sequence: MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAAS Predict reactive species Full Name: neural precursor cell expressed, developmentally down-regulated 1 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 71-75 kDa GenBank Accession Number: BC027605 Gene Symbol: NEDD1 Gene ID (NCBI): 121441 RRID: AB_3671084 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8NHV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924