Proteintech, 83470-3-RR, RABL2B Recombinant monoclonal antibody

Size: 20ul / 100ul The RABL2B (83470-3-RR) by Proteintech is a Recombinant antibody targeting RABL2B in WB, FC (Intra), ELISA applications with reactivity to human samples 83470-3-RR targets RABL2B in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells Positive FC (Intra) detected in: A549 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Rab-like protein 2B (RABL2B) is a member of a poorly characterised clade of the RAS GTPase superfamily, which plays an essential role in male fertility, sperm intraflagellar transport and tail assembly (PMID: 28553998, PMID: 28138870). A preferential expression of RABL2B in human tissues and lymphoblastoid cell lines was detected which is most pronounced in brain and placenta (PMID: 20138207). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2189 Product name: Recombinant human RABL2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC024281 Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS Predict reactive species Full Name: RAB, member of RAS oncogene family-like 2B Calculated Molecular Weight: 229 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC024281 Gene Symbol: RABL2B Gene ID (NCBI): 11158 RRID: AB_3671100 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UNT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.