Iright
BRAND / VENDOR: Proteintech

Proteintech, 83473-3-RR, DENND6A Recombinant monoclonal antibody

CATALOG NUMBER: 83473-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The DENND6A (83473-3-RR) by Proteintech is a Recombinant antibody targeting DENND6A in WB, FC (Intra), ELISA applications with reactivity to human samples 83473-3-RR targets DENND6A in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, HEK-293 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FAM116A has DENN-related domains, which are required for cell migration. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22052 Product name: Recombinant human FAM116A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC040291 Sequence: MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSA Predict reactive species Full Name: family with sequence similarity 116, member A Calculated Molecular Weight: 608 aa, 70 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC040291 Gene Symbol: FAM116A Gene ID (NCBI): 201627 RRID: AB_3671102 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IWF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924