Iright
BRAND / VENDOR: Proteintech

Proteintech, 83477-7-RR, TrkA Recombinant monoclonal antibody

CATALOG NUMBER: 83477-7-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TrkA (83477-7-RR) by Proteintech is a Recombinant antibody targeting TrkA in WB, ELISA applications with reactivity to human samples 83477-7-RR targets TrkA in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information NTRK1(Neurotrophic tyrosine kinase receptor 1) is located on chromosome 1q23.1 and is responsible for a rare genetic disorder, CIPA (congenital insensitivity to pain with anhidrosis) (PMID: 37907480). As a neurotrophin receptor, NTRK1 is abundantly expressed in human neuronal tissues and plays an integral role in the development and function of the human nervous system (PMID: 27843590). NTRK1 also regulates the survival and proliferation of cholinergic neurons (PMID: 20054812). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32759 Product name: Recombinant human NTRK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 537-796 aa of NM_001007792 Sequence: DKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG Predict reactive species Full Name: neurotrophic tyrosine kinase, receptor, type 1 Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: NM_001007792 Gene Symbol: NTRK1 Gene ID (NCBI): 4914 RRID: AB_3671106 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P04629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924