Iright
BRAND / VENDOR: Proteintech

Proteintech, 83492-7-RR, HTRA2 Recombinant monoclonal antibody

CATALOG NUMBER: 83492-7-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HTRA2 (83492-7-RR) by Proteintech is a Recombinant antibody targeting HTRA2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83492-7-RR targets HTRA2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, MCF-7 cells, Raji cells, Jurkat cells, human heart tissue Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information HTRA2(High temperature requirement protein A2) is also named as OMI, PRSS25 and belongs to the peptidase S1B family. HTRA2 normally exists in the mitochondria, can cause MMP3 activation in the cytosol under a cell stress condition, which can ultimately lead to demise of dopaminergic neuronal cells(PMID: 22265821). It inhibits mitochondrial superoxide generation, stabilizes mitochondrial membrane potential, and prevents apoptosis at baseline and in response to extracellular inducers of mitochondrial stress(PMID: 18772386). This protein has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8455 Product name: Recombinant human HTRA2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 133-458 aa of BC000096 Sequence: AAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE Predict reactive species Full Name: HtrA serine peptidase 2 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC000096 Gene Symbol: HTRA2 Gene ID (NCBI): 27429 RRID: AB_3671119 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O43464 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924