Proteintech, 83500-4-RR, C6orf130 Recombinant monoclonal antibody

Size: 20ul / 100ul The C6orf130 (83500-4-RR) by Proteintech is a Recombinant antibody targeting C6orf130 in WB, FC (Intra), ELISA applications with reactivity to human samples 83500-4-RR targets C6orf130 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HCT 116 cells Positive FC (Intra) detected in: A431 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information OARD1 (O-acetyl-ADP-ribose deacetylase 1), also known as TARG1 (Terminal ADP-ribose protein glycohydrolase 1) and C6orf130, is a ADP-ribose glycohydrolase that hydrolyzes ADP-ribose and acts on different substrates, such as proteins ADP-ribosylated on glutamate and O-acetyl-ADP-D-ribose (PMID: 21849506; 23474714; 23481255). The MW of this protein is 17 kDa, and this antibody specially recognises the 17 kDa protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19341 Product name: Recombinant human C6orf130 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC011709 Sequence: MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL Predict reactive species Full Name: chromosome 6 open reading frame 130 Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC011709 Gene Symbol: C6orf130 Gene ID (NCBI): 221443 RRID: AB_3671126 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y530 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.