Proteintech, 83509-6-RR, FBXO38 Recombinant monoclonal antibody

Size: 20ul / 100ul The FBXO38 (83509-6-RR) by Proteintech is a Recombinant antibody targeting FBXO38 in WB, ELISA applications with reactivity to human samples 83509-6-RR targets FBXO38 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, Jurkat cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FBXO38, also known as HMN2D, MOKA, and SP329, is a protein that plays a significant role in the regulation of immune responses, particularly in the context of cancer and autoimmune diseases. FBXO38 has been identified as an E3 ubiquitin ligase that mediates the degradation of PD-1 (Programmed cell death protein 1), a key immune checkpoint protein expressed on the surface of T cells. The internalization, ubiquitination, and proteasome degradation of PD-1 are facilitated by FBXO38, which links PD-1 to Lys48, leading to its poly-ubiquitination and subsequent degradation (PMID: 30487606). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35444 Product name: Recombinant human FBXO38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 490-700 aa of XM_005268513.1 Sequence: SNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADALNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSESDDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQSKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDV Predict reactive species Full Name: F-box protein 38 Calculated Molecular Weight: 134kDa，1188aa Observed Molecular Weight: 133 kDa GenBank Accession Number: XM_005268513.1 Gene Symbol: FBXO38 Gene ID (NCBI): 81545 RRID: AB_3671134 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q6PIJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.