Proteintech, 83520-3-RR, SMPD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMPD2 (83520-3-RR) by Proteintech is a Recombinant antibody targeting SMPD2 in WB, FC (Intra), ELISA applications with reactivity to human samples 83520-3-RR targets SMPD2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293T cells, MOLT-4 cells, SH-SY5Y cells Positive FC (Intra) detected in: HeLa cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SMPD2, Sphingomyelin phosphodiesterase 2, is also named as Lyso-platelet-activating factor-phospholipase C and neutral sphingomyelinase (nSMase). It is involved in the sphingolipid metabolism pathway, which can catalyze the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Smpd2/Smpd3 double-mutant mice were found to have severe retardation of late embryonic and postnatal growth and delayed puberty, belonging to hypothalamus-induced combined pituitary hormone deficiency (PubMed: 15764706). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7367 Product name: Recombinant human SMPD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC000038 Sequence: MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLRQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGLLVLHLSGMVLNAYVTHLHAEYNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHSGTPLSDHEALMATLFVRHSPPQQNPSSTHGPAERSP Predict reactive species Full Name: sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC000038 Gene Symbol: SMPD2 Gene ID (NCBI): 6610 RRID: AB_3671146 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60906 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.