Proteintech, 83534-1-RR, GBP3 Recombinant monoclonal antibody

Size: 20ul / 100ul The GBP3 (83534-1-RR) by Proteintech is a Recombinant antibody targeting GBP3 in WB, FC (Intra), ELISA applications with reactivity to human samples 83534-1-RR targets GBP3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, Jurkat cells, HUVEC cells, U-251 cells Positive FC (Intra) detected in: HT-29 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa. Specification Tested Reactivity: human Cited Reactivity: monkey Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33889 Product name: Recombinant human GBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 535-595 aa of BC140837 Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI* Predict reactive species Full Name: guanylate binding protein 3 Observed Molecular Weight: 62 kDa, 68 kDa GenBank Accession Number: BC140837 Gene Symbol: GBP3 Gene ID (NCBI): 2635 RRID: AB_3671159 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9H0R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.