Iright
BRAND / VENDOR: Proteintech

Proteintech, 83536-1-RR, FEM1C Recombinant monoclonal antibody

CATALOG NUMBER: 83536-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The FEM1C (83536-1-RR) by Proteintech is a Recombinant antibody targeting FEM1C in WB, FC (Intra), ELISA applications with reactivity to human samples 83536-1-RR targets FEM1C in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Protein fem-1 homolog C (FEM1C) is involved in protein modification and ubiquitination.Probable component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit.Highly expressed in kidney, cardiac tissue, skeletal muscle and testis. Expressed at lower levels in other tissues, including cartilage.This antibody specifically recognizes the 69kd FEM1C protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5099 Product name: Recombinant human FEM1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 315-617 aa of BC028369 Sequence: PDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGKNNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNHPDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHIPEKLETFVSLHR Predict reactive species Full Name: fem-1 homolog c (C. elegans) Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC028369 Gene Symbol: FEM1C Gene ID (NCBI): 56929 RRID: AB_3671160 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96JP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924