Proteintech, 83556-5-RR, MYO1G Recombinant monoclonal antibody

Size: 20ul / 100ul The MYO1G (83556-5-RR) by Proteintech is a Recombinant antibody targeting MYO1G in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83556-5-RR targets MYO1G in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Ramos cells Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MYO1G is a plasma membrane-associated class I myosin that is abundant in T and B lymphocytes and mast cells and expressed specifically in the haematopoietic system. Class I myosins have been implicated in various cellular processes relying on actin-dependent membrane dynamics such as endocytosis, secretion, adhesion, motility and regulation of mechanosensitive channels (PMID: 19968988). MYO1G localizes to the plasma membrane linked to PIP2 and PIP3, is particularly enriched at cell-surface microvilli, and associates in an ATP-releasable manner to the actin cytoskeleton (PMID: 24310084). MYO1G can be detected as about 110-120 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22698 Product name: Recombinant human MYO1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-391 aa of BC113544 Sequence: RVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVMEPRGRDPRRDGKDTVI Predict reactive species Full Name: myosin IG Calculated Molecular Weight: 1018 aa, 116 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC113544 Gene Symbol: MYO1G Gene ID (NCBI): 64005 RRID: AB_3671173 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: B0I1T2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.