Proteintech, 83561-6-RR, MAGI2 Recombinant monoclonal antibody

Size: 20ul / 100ul The MAGI2 (83561-6-RR) by Proteintech is a Recombinant antibody targeting MAGI2 in WB, ELISA applications with reactivity to human, rat samples 83561-6-RR targets MAGI2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information MAGI proteins are scaffolding proteins, belonging to the Membrane-Associated Guanylate Kinase Inverted proteins of the MAGUK family. There are three members of the MAGI subfamily, MAGI-1, MAGI-2, and MAGI-3. They are comprised of 6 PDZ domains, 2 WW domains, and 1 GUK domain. They have been proven to mediate the transport and signal transduction of various G protein-coupled receptors (GPCRs) (PMID: 29625175). The antibody is specific to MAGI2. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18279 Product name: Recombinant human MAGI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 563-912 aa of BC150277 Sequence: DRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRRPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRK Predict reactive species Full Name: membrane associated guanylate kinase, WW and PDZ domain containing 2 Calculated Molecular Weight: 1455 aa, 159 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC150277 Gene Symbol: MAGI2 Gene ID (NCBI): 9863 RRID: AB_3671176 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q86UL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.