Iright
BRAND / VENDOR: Proteintech

Proteintech, 83564-5-RR, SYTL4 Recombinant monoclonal antibody

CATALOG NUMBER: 83564-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SYTL4 (83564-5-RR) by Proteintech is a Recombinant antibody targeting SYTL4 in WB, ELISA applications with reactivity to human samples 83564-5-RR targets SYTL4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SYTL4, also known as SLP4 or granuphilin, is a member of the synaptotagmin-like protein (Slp) family. Members of this family are characterized by presence of an N-terminal Slp homology domain (SHD), which functions as a Rab27-binding domain, and C-terminal tandem C2 domains, putative Ca(2+)-binding motifs. SYTL4 is specifically expressed on dense-core granules in certain neuroendocrine cells and negatively controls dense-core vesicle exocytosis through specific interaction with Rab27A. (PMID: 16481396; 16473610) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2772 Product name: Recombinant human SYTL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 338-671 aa of BC014913 Sequence: IGSMMSIYSEAGDFGNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTVNPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL Predict reactive species Full Name: synaptotagmin-like 4 Calculated Molecular Weight: 671 aa, 76 kDa Observed Molecular Weight: 74-76 kDa GenBank Accession Number: BC014913 Gene Symbol: SYTL4 Gene ID (NCBI): 94121 RRID: AB_3671179 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96C24 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924