Proteintech, 83565-1-RR, MRPL51 Recombinant monoclonal antibody

Size: 20ul / 100ul The MRPL51 (83565-1-RR) by Proteintech is a Recombinant antibody targeting MRPL51 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 83565-1-RR targets MRPL51 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, HEK-293 cells, SKOV-3 cells Positive IHC detected in: human lung cancer tissue, human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mitochondrial ribosome protein L51 (MRPL51) is a 39S subunit protein of the mitochondrial ribosome. MRPL51 functions in the translation of genetic messages (PMID: 21730110). MRPL51 expression was positively correlated with cell cycle, DNA damage, DNA repair, epithelial-mesenchymal transition, invasion, and proliferation of LUAD cells at the single cell level (PMID: 37323822). The calculated molecular weight of MRPL51 is 15 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7193 Product name: Recombinant human MRPL51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC000191 Sequence: MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR Predict reactive species Full Name: mitochondrial ribosomal protein L51 Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC000191 Gene Symbol: MRPL51 Gene ID (NCBI): 51258 RRID: AB_3671180 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q4U2R6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.