Proteintech, 83577-4-RR, GAR1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GAR1 (83577-4-RR) by Proteintech is a Recombinant antibody targeting GAR1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83577-4-RR targets GAR1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, mouse skin tissue Positive FC (Intra) detected in: K562 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information GAR1, other named NOLA1, is a subunit of H/ACA and telomerase. Thought is not required for H/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2282 Product name: Recombinant human GAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC003413 Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH Predict reactive species Full Name: GAR1 ribonucleoprotein homolog (yeast) Calculated Molecular Weight: 217 aa, 22 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC003413 Gene Symbol: GAR1 Gene ID (NCBI): 54433 RRID: AB_3671189 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NY12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.