Proteintech, 83602-5-RR, Cryptochrome 1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Cryptochrome 1 (83602-5-RR) by Proteintech is a Recombinant antibody targeting Cryptochrome 1 in WB, ELISA applications with reactivity to human samples 83602-5-RR targets Cryptochrome 1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Y79 cells, HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Cryptochrome circadian clock 1 (CRY1) is a flavin adenine dinucleotide-binding protein with MW of 66 kDa. CRY1 is a key component of the circadian core oscillator complex, which regulates the circadian clock. CRY1 predominantly displays evening-time expression and serves as a strong repressor of morning-time elements (E box/E-prime box) when bound to the BMAL1 (ARNTL; 602550)/CLOCK (601851) complex (PubMed: 21236481). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4270 Product name: Recombinant human CRY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 236-586 aa of BC030519 Sequence: RPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN Predict reactive species Full Name: cryptochrome 1 (photolyase-like) Calculated Molecular Weight: 586 aa, 66 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC030519 Gene Symbol: CRY1 Gene ID (NCBI): 1407 RRID: AB_3671216 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q16526 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.