Product Description
Size: 20ul / 100ul
The C11orf67 (83603-4-RR) by Proteintech is a Recombinant antibody targeting C11orf67 in WB, ELISA applications with reactivity to human, mouse, rat samples
83603-4-RR targets C11orf67 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, MCF-7 cells, SKOV-3 cells, rat testis tissue, mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
C11orf67 is predicted to be involved in positive regulation of fat cell differentiation.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag14258 Product name: Recombinant human C11orf67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC002752 Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC Predict reactive species
Full Name: chromosome 11 open reading frame 67
Calculated Molecular Weight: 122 aa, 13 kDa
Observed Molecular Weight: 13 kDa
GenBank Accession Number: BC002752
Gene Symbol: C11orf67
Gene ID (NCBI): 28971
RRID: AB_3671217
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q9H7C9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924