Iright
BRAND / VENDOR: Proteintech

Proteintech, 83615-4-RR, CNOT4 Recombinant monoclonal antibody

CATALOG NUMBER: 83615-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CNOT4 (83615-4-RR) by Proteintech is a Recombinant antibody targeting CNOT4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83615-4-RR targets CNOT4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HEK-293T cells, HeLa cells, K-562 cells, Jurkat cells, NIH/3T3 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CNOT4, also known as CCR4-NOT transcription complex subunit 4 , has E3 ubiquitin ligase activity, and promotes ubiquitination and degradation of target proteins. CNOT4 is involved in activation of the JAK/STAT pathway. CNOT4 exist many isoforms and the range of its molecular weight from 48 to 84 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3163 Product name: Recombinant human CNOT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-572 aa of BC035590 Sequence: IDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA Predict reactive species Full Name: CCR4-NOT transcription complex, subunit 4 Calculated Molecular Weight: 575 aa, 64 kDa Observed Molecular Weight: 64-85 kDa GenBank Accession Number: BC035590 Gene Symbol: CNOT4 Gene ID (NCBI): 4850 RRID: AB_3671229 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95628 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924