Iright
BRAND / VENDOR: Proteintech

Proteintech, 83620-5-RR, Neurofibromin Recombinant monoclonal antibody

CATALOG NUMBER: 83620-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Neurofibromin (83620-5-RR) by Proteintech is a Recombinant antibody targeting Neurofibromin in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83620-5-RR targets Neurofibromin in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, PC-12 cell, NIH/3T3 cells, HEK-293T cells, HeLa cells Positive FC (Intra) detected in: HeLa cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NF1 codes for neurofibromin, a GTPase-activating protein that negatively regulates RAS/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25799 Product name: Recombinant human Neurofibromin protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of M60915 Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD Predict reactive species Full Name: neurofibromin 1 Calculated Molecular Weight: 319 kDa Observed Molecular Weight: 250-280 kDa GenBank Accession Number: M60915 Gene Symbol: Neurofibromin 1 Gene ID (NCBI): 4763 RRID: AB_3671233 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21359 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924