Iright
BRAND / VENDOR: Proteintech

Proteintech, 83621-6-RR, CDK8 Recombinant monoclonal antibody

CATALOG NUMBER: 83621-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CDK8 (83621-6-RR) by Proteintech is a Recombinant antibody targeting CDK8 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83621-6-RR targets CDK8 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, NIH/3T3 cells, RAW 264.7 cells, A549 cells, HCT 116 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17148 Product name: Recombinant human CDK8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 360-464 aa of BC069634 Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Predict reactive species Full Name: cyclin-dependent kinase 8 Calculated Molecular Weight: 464 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC069634 Gene Symbol: CDK8 Gene ID (NCBI): 1024 RRID: AB_3671234 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P49336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924