Proteintech, 83635-4-RR, CDK2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CDK2 (83635-4-RR) by Proteintech is a Recombinant antibody targeting CDK2 in WB, FC (Intra), ELISA applications with reactivity to human, rat samples 83635-4-RR targets CDK2 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells, K-562 cells, HEK-293 cells, HeLa cells, HepG2 cells, C6 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily,CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily.It is involved in the control of the cell cycle; essential for meiosis, but dispensable for mitosis.It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species Full Name: cyclin-dependent kinase 2 Calculated Molecular Weight: 298 aa, 34 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC003065 Gene Symbol: CDK2 Gene ID (NCBI): 1017 RRID: AB_3671246 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P24941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.