Proteintech, 83635-5-RR, CDK2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CDK2 (83635-5-RR) by Proteintech is a Recombinant antibody targeting CDK2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83635-5-RR targets CDK2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells, K-562 cells, HEK-293 cells, HeLa cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells, HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily. It is dispensable for myelination but is important for adult oligodendrocyte progenitor cell renewal, and could be one of the underlying mechanisms that drive adult progenitors to differentiate and thus regenerate myelin(PMID:21502361). G2 phase CCNA1/CDK2 controls the timing of entry into mitosis by controlling the subsequent activation of CCNB/CDK1, but also has an unexpected role in coordinating the activation of CCNB/CDK1 at the centrosome and in the nucleus(PMID:18372919). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species Full Name: cyclin-dependent kinase 2 Calculated Molecular Weight: 298 aa, 34 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC003065 Gene Symbol: CDK2 Gene ID (NCBI): 1017 RRID: AB_3671247 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P24941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.