Iright
BRAND / VENDOR: Proteintech

Proteintech, 83641-4-RR, TADA1L Recombinant monoclonal antibody

CATALOG NUMBER: 83641-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TADA1L (83641-4-RR) by Proteintech is a Recombinant antibody targeting TADA1L in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83641-4-RR targets TADA1L in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, human testis tissue, HepG2 cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The function of TADA1L has not been widely studied, and is yet to be fully elucidated. It probably involved in transcriptional regulation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14118 Product name: Recombinant human TADA1L protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-335 aa of BC015401 Sequence: MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC Predict reactive species Full Name: transcriptional adaptor 1 (HFI1 homolog, yeast)-like Calculated Molecular Weight: 335 aa, 37 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC015401 Gene Symbol: TADA1L Gene ID (NCBI): 117143 RRID: AB_3671252 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96BN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924