Iright
BRAND / VENDOR: Proteintech

Proteintech, 83650-1-RR, RNASET2 Recombinant monoclonal antibody

CATALOG NUMBER: 83650-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The RNASET2 (83650-1-RR) by Proteintech is a Recombinant antibody targeting RNASET2 in WB, ELISA applications with reactivity to human samples 83650-1-RR targets RNASET2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HL-60 cells, THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RNASET2(Ribonuclease T2) is also named as RNASE6PL(Ribonuclease 6) and belongs to the RNase T2 family. It is a unique member of the growing family of tumor-antagonizing genes and behaves as a class II tumor suppressor and abolish the tumorigenic potential of an ovarian cancer-derived cell line. This protein has 2 isoforms produced by alternative splicing. Both mildly glycosylated (ranging from38 to 45 kDa) and highly glycosylated forms (ranging from 50 to 80 kDa) of human tumor suppressor protein RNASET2 can be detected in immunoblotting in P. Pastoris(PMID: 21446958). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28353 Product name: Recombinant human RNASET2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-256 aa of BC039713 Sequence: DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH Predict reactive species Full Name: ribonuclease T2 Calculated Molecular Weight: 256 aa, 29 kDa Observed Molecular Weight: 25-45 kDa GenBank Accession Number: BC039713 Gene Symbol: RNase T2 Gene ID (NCBI): 8635 RRID: AB_3671259 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924