Proteintech, 83657-5-RR, LPXN Recombinant monoclonal antibody

Size: 20ul / 100ul The LPXN (83657-5-RR) by Proteintech is a Recombinant antibody targeting LPXN in WB, IF/ICC, ELISA applications with reactivity to human samples 83657-5-RR targets LPXN in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells, PC-3 cells, Jurkat cells, MDA-MB-231 cells Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information LPXN, also known as Leupaxin, LDPL, belongs to the paxillin family. LPXN Contributes to the regulation of cell adhesion, spreading, and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events (PMID: 20543562). LPXN has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of the focal adhesion kinase family (PMID: 9565592). Studies in breast cancer implicate LPXN is involved in the regulation of ER action as a co-factor (PMID: 25955236). LPXN is expressed in prostate cancer cells and its expression intensity is directly linked to PCa progression (PMID: 18451096). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34956 Product name: Recombinant human LPXN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-132 aa of BC019035 Sequence: DALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML Predict reactive species Full Name: leupaxin Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC019035 Gene Symbol: LPXN Gene ID (NCBI): 9404 RRID: AB_3671265 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O60711 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.