Proteintech, 83670-1-RR, POLG Recombinant monoclonal antibody

Size: 20ul / 100ul The POLG (83670-1-RR) by Proteintech is a Recombinant antibody targeting POLG in WB, ELISA applications with reactivity to human, rat samples 83670-1-RR targets POLG in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat brain tissue, rat testis tissue, HepG2 cells, HEK-293T cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information POLG (DNA polymerase gamma) is composed of a C-terminal polymerase ('pol') domain and an amino-terminal exonuclease ('exo') domain. The exo domain increases the fidelity of mitochondrial DNA replication by conferring a proofreading activity to the enzyme (PMID: 12210792). Catalytic subunit of POLG solely responsible for replication of mitochondrial DNA (mtDNA). Replicates both heavy and light strands of the circular mtDNA genome using a single-stranded DNA template, RNA primers and the four deoxyribonucleoside triphosphates as substrates (PMID:11477093; 11897778; 15917273; 19837034; 9558343). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5256 Product name: Recombinant human POLG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 888-1239 aa of BC042571 Sequence: GADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP Predict reactive species Full Name: polymerase (DNA directed), gamma Calculated Molecular Weight: 140 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC042571 Gene Symbol: POLG Gene ID (NCBI): 5428 RRID: AB_3671275 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P54098 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.