Proteintech, 83712-4-RR, RAE1 Recombinant monoclonal antibody

Size: 20ul / 100ul The RAE1 (83712-4-RR) by Proteintech is a Recombinant antibody targeting RAE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 83712-4-RR targets RAE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, HeLa cells, HEK-293 cells, BxPC-3 cells, mouse thymus tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information RAE1 acts as a mRNA export factor involved in nucleocytoplasmic transport, it plays a role in mitotic bipolar spindle formation. (PMID: 33849972, MID: 17172455) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12102 Product name: Recombinant human RAE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-368 aa of BC103754 Sequence: MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK Predict reactive species Full Name: RAE1 RNA export 1 homolog (S. pombe) Calculated Molecular Weight: 368 aa, 41 kDa GenBank Accession Number: BC103754 Gene Symbol: RAE1 Gene ID (NCBI): 8480 RRID: AB_3671316 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P78406 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.