Iright
BRAND / VENDOR: Proteintech

Proteintech, 83750-4-RR, CKMT1A Recombinant monoclonal antibody

CATALOG NUMBER: 83750-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CKMT1A (83750-4-RR) by Proteintech is a Recombinant antibody targeting CKMT1A in WB, ELISA applications with reactivity to human, mouse, rat samples 83750-4-RR targets CKMT1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HepG2 cells, SH-SY5Y cells, mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information CKMT1A(Creatine kinase U-type, mitochondrial) is also named CKMT and belongs to the ATP:guanido phosphotransferase family. CKMT1A is a nearly identical copy of the CKMT1B gene. Both genes encode an identical CKMT1 protein(PMID:17098888). It reversibly catalyzes the transfer of phosphate between ATP and various phosphates. It has 2 isoforms produced by alternative splicing with the molecular weight of 47 kDa and 50 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7583 Product name: Recombinant human CKMT1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-417 aa of BC001926 Sequence: SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH Predict reactive species Full Name: creatine kinase, mitochondrial 1A Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC001926 Gene Symbol: CKMT1A Gene ID (NCBI): 548596 RRID: AB_3671346 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P12532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924