Proteintech, 83759-5-RR, AGER/RAGE Recombinant monoclonal antibody

Size: 20ul / 100ul The AGER/RAGE (83759-5-RR) by Proteintech is a Recombinant antibody targeting AGER/RAGE in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples 83759-5-RR targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse heart tissue Positive IHC detected in: mouse lung tissue, rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1135 Product name: Recombinant Rat AGER/RAGE protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-341 aa of Sequence: GQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRRRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLAL Predict reactive species Full Name: advanced glycosylation end product-specific receptor Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa Gene Symbol: Ager Gene ID (NCBI): 81722 RRID: AB_3671355 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q63495 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.