Proteintech, 83785-6-RR, ATOX1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ATOX1 (83785-6-RR) by Proteintech is a Recombinant antibody targeting ATOX1 in WB, FC (Intra), ELISA applications with reactivity to human samples 83785-6-RR targets ATOX1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, A549 cells, HEK-293 cells, NCI-H1299 cells, HepG2 cells, Jurkat cells Positive FC (Intra) detected in: HeLa cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Antioxidant 1 (ATOX1) is a copper chaperone to regulate copper homeostasis in cell. In the cytosol, ATOX1 always binds to copper and transfer to ATPase proteins in the trans-Golgi network, thereby promoting copper supply to various copper-dependent oxidereductases matured within the secretory vesicles (PMID: 28294521). Also, the protein could protect cells against oxidative damage and the expression levels of ATOX1 may help to the inflammatory response and antioxidant defense,even to modulate response to the cancer (PMID: 27472369). ATOX1 plays an important role in the physiology of the human central nervous system ,and it's highly expressed in the cerebral cortex and hippocampus (PMID: 30545441). Either cytosol or nucleus location of ATOX1 has been reported in different literations, which may be associated with cell status (PMID: 24445997; 31317143). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18460 Product name: Recombinant human ATOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC112248 Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Predict reactive species Full Name: ATX1 antioxidant protein 1 homolog (yeast) Calculated Molecular Weight: 68 aa, 8 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC112248 Gene Symbol: ATOX1 Gene ID (NCBI): 475 RRID: AB_3671377 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.