Proteintech, 83791-6-RR, CEBPB Recombinant monoclonal antibody

Size: 20ul / 100ul The CEBPB (83791-6-RR) by Proteintech is a Recombinant antibody targeting CEBPB in WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, mouse samples 83791-6-RR targets CEBPB in WB, IHC, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, U-87 MG cells, MKN-45 cells, MDA-MB-231 cells Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Positive ChIP-qPCR detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information CCAAT/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein.Three variants of CEBPBs have been detected: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20 kDa liver-enriched transcription-inhibitory protein (LIP). (PMID:18820298). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20073 Product name: Recombinant human CEBPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC007538 Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT Predict reactive species Full Name: CCAAT/enhancer binding protein (C/EBP), beta Calculated Molecular Weight: 345 aa, 36 kDa Observed Molecular Weight: 42 kDa, 46 kDa GenBank Accession Number: BC007538 Gene Symbol: CEBPB Gene ID (NCBI): 1051 RRID: AB_3671382 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P17676 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.