Iright
BRAND / VENDOR: Proteintech

Proteintech, 83808-1-RR, GATA3 Recombinant monoclonal antibody

CATALOG NUMBER: 83808-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The GATA3 (83808-1-RR) by Proteintech is a Recombinant antibody targeting GATA3 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83808-1-RR targets GATA3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: EL-4 cells, MCF-7 cells, SH-SY5Y cells, T-47D cells Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: Jurkat cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Trans-acting T-cell-specific transcription factor, also known as GATA3, belongs to the zinc-finger transcription factor GATA family which drives the differentiation of T helper (Th) 2 cells. GATA factors are expressed in a tissue-specific manner and GATA3 is present in both hematopoietic (e.g., T cells) and non-hematopoietic tissues, including the kidney, central nervous system, skin, and mammary gland (PMID: 25148023). GATA3 plays a central role in Th2 responses both in vitro and in vivo (PMID: 16467870). The full-length GATA3 protein contains 444 aa corresponding to the molecular weights of 48 kDa, and the truncated protein was detected at approximately 37 kDa (PMID: 24758297). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0174 Product name: Recombinant human GATA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-442 aa of BC003070 Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM Predict reactive species Full Name: GATA binding protein 3 Calculated Molecular Weight: 443 aa, 48 kDa Observed Molecular Weight: 37 kDa and 48 kDa GenBank Accession Number: BC003070 Gene Symbol: GATA3 Gene ID (NCBI): 2625 RRID: AB_3671395 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P23771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924