Iright
BRAND / VENDOR: Proteintech

Proteintech, 83820-5-RR, CPNE3 Recombinant monoclonal antibody

CATALOG NUMBER: 83820-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CPNE3 (83820-5-RR) by Proteintech is a Recombinant antibody targeting CPNE3 in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 83820-5-RR targets CPNE3 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Y79 cells, A431 cells, HepG2 cells, A549 cells, HeLa cells, HuH-7 cells Positive IP detected in: HepG2 cells Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:14000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Copines are a family of evolutionarily conserved calcium-dependent phospholipid-binding proteins (PMID: 9430674). They contain two Ca(2+)- and phospholipid-binding domains known as C2 domains. Copines are potentially involved in regulating membrane trafficking and in protein-protein interactions. Copine III (CPNE3) has also been identified as a ligand of ERBB2 and plays an important role in various carcinogenesis. The high expression of CPNE3 is an adverse prognostic biomarker for acute myeloid leukemia (PMID: 28670859). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1634 Product name: Recombinant human CPNE3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-537 aa of BC036242 Sequence: EASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTFLDYIMGGCQLNFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQIPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRSCLPQIKLYGQTNFSPIINHVARFAAAATQQQTASRYFVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLHSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ Predict reactive species Full Name: copine III Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC036242 Gene Symbol: CPNE3 Gene ID (NCBI): 8895 RRID: AB_3671405 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75131 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924