Iright
BRAND / VENDOR: Proteintech

Proteintech, 83823-5-RR, GADD45GIP1 Recombinant monoclonal antibody

CATALOG NUMBER: 83823-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The GADD45GIP1 (83823-5-RR) by Proteintech is a Recombinant antibody targeting GADD45GIP1 in WB, IHC, ELISA applications with reactivity to human samples 83823-5-RR targets GADD45GIP1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, Jurkat cells, U-251 cells Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Growth arrest and DNA-damage-inducible proteins-interacting protein 1(GADD45GIP1), also known as CRIF1, is newly identified de novo components in large subunit of mitoribosome. It is essential for the translation of mitochondrial oxidative phosphorylation (OXPHOS) polypeptides in mammalian mitochondria. The essential role of CRIF1 in mitochondrial synthesis and membrane integration of OXPHOS polypeptides was shown in brain-specific CRIF1-deficient mice, which exhibited profound OXPHOS failure and marked neurodegeneration. (PMID 22819524) In addition, GADD45GIP1 enhances the function of GADD45 in maintaining genome stability, DNA repair and cell cycle regulation by interacting with the GADD45 protein family. It's reported that GADD45GIP1 may be induced by p53, a process that is closely related to the cell's response to DNA damage.(PMID:28599472) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9299 Product name: Recombinant human GADD45GIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC013027 Sequence: AASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS Predict reactive species Full Name: growth arrest and DNA-damage-inducible, gamma interacting protein 1 Calculated Molecular Weight: 222 aa, 25 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC013027 Gene Symbol: GADD45GIP1 Gene ID (NCBI): 90480 RRID: AB_3671407 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8TAE8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924