Proteintech, 83827-3-RR, ATP2B1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ATP2B1 (83827-3-RR) by Proteintech is a Recombinant antibody targeting ATP2B1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 83827-3-RR targets ATP2B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32423 Product name: Recombinant human ATP2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-89 aa of NM_001001323.1 Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF Predict reactive species Full Name: ATPase, Ca++ transporting, plasma membrane 1 Calculated Molecular Weight: 135 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: NM_001001323.1 Gene Symbol: ATP2B1 Gene ID (NCBI): 490 RRID: AB_3671411 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20020 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.