Proteintech, 83831-5-RR, PROSC Recombinant monoclonal antibody

Size: 20ul / 100ul The PROSC (83831-5-RR) by Proteintech is a Recombinant antibody targeting PROSC in WB, IHC, ELISA applications with reactivity to human, mouse samples 83831-5-RR targets PROSC in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, Jurkat cells, L02 cells, mouse liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:325-1:1300 Background Information Human Pyridoxal 5′-phosphate-binding protein (PLPBP; previously proline synthase cotranscribed homolog, PROSC) was first described in 1999 and was demonstrated to be ubiquitously expressed in many tissues. PROSC is ubiquitously expressed in human tissues and is highly conserved throughout evolution. PROSC deficiency could therefore markedly increase free cellular PLP levels (PMID: 31825581, 27912044). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18369 Product name: Recombinant human PROSC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC012334 Sequence: MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH Predict reactive species Full Name: proline synthetase co-transcribed homolog (bacterial) Calculated Molecular Weight: 275 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012334 Gene Symbol: PROSC Gene ID (NCBI): 11212 RRID: AB_3671415 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O94903 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.