Proteintech, 83856-5-RR, MIOS Recombinant monoclonal antibody

Size: 20ul / 100ul The MIOS (83856-5-RR) by Proteintech is a Recombinant antibody targeting MIOS in WB, ELISA applications with reactivity to human, mouse, rat samples 83856-5-RR targets MIOS in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The mechanistic target of rapamycin complex 1 (mTORC1) controls growth by regulating anabolic and catabolic processes in response to environmental cues, including nutrients. Amino acids signal to mTORC1 through the Rag GTPases, which are regulated by several protein complexes, including GATOR1 and GATOR2. GATOR2, which has five components (WDR24, MIOS, WDR59, SEH1L, SEC13), is required for amino acids to activate mTORC1. PMID: 35831510 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15148 Product name: Recombinant human MIOS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 188-537 aa of BC005883 Sequence: AVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETGSYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTASYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP Predict reactive species Full Name: missing oocyte, meiosis regulator, homolog (Drosophila) Calculated Molecular Weight: 875 aa, 99 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: BC005883 Gene Symbol: MIOS Gene ID (NCBI): 54468 RRID: AB_3671441 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NXC5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.