Iright
BRAND / VENDOR: Proteintech

Proteintech, 83861-1-RR, RPE65 Recombinant monoclonal antibody

CATALOG NUMBER: 83861-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The RPE65 (83861-1-RR) by Proteintech is a Recombinant antibody targeting RPE65 in WB, ELISA applications with reactivity to human samples 83861-1-RR targets RPE65 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RPE65(Retinal pigment epithelium-specific 65 kDa protein) is also named as retinoid isomerohydrolase with the calculated molecular weight og 61 kDa and belongs to the carotenoid oxygenase family. It is a microsomal protein with isomerase activity in the retinoid visual cycle that playing a role in the isomerisation of all-trans (vitamin A) to 11-cis retinal, the chromophore of the visual pigments. It also might be involved in retinoid uptake of keratinocytes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12356 Product name: Recombinant human RPE65 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-533 aa of BC075036 Sequence: YNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS Predict reactive species Full Name: retinal pigment epithelium-specific protein 65kDa Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 65 kDa, 61 kDa GenBank Accession Number: BC075036 Gene Symbol: RPE65 Gene ID (NCBI): 6121 RRID: AB_3671445 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q16518 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924